missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79292
This item is not returnable.
View return policy
Description
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Polyclonal specifically detects ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 in Human samples. It is validated for Western Blot.
Specifications
| ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2, 8-polysialytransferase) D, Sialyltransferase 8D, Sialytransferase St8Sia IV, SIAT8D, SIAT8-D, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, ST8SiaIV, ST8SIA-IV | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_005659 | |
| ST8SIA4 | |
| Synthetic peptide directed towards the middle region of human ST8SIA4The immunogen for this antibody is ST8SIA4. Peptide sequence DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM. | |
| 100 μL | |
| Neuroscience | |
| 7903 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction