missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STAM-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 792.00
Specifications
| Antigen | STAM-1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18140828
|
Novus Biologicals
NBP2-38514 |
0.1 mL |
€ 792.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669905
|
Novus Biologicals
NBP2-38514-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STAM-1 Polyclonal specifically detects STAM-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| STAM-1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q92783 | |
| 8027 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686J2352, HSE1 homolog, signal transducing adapter molecule 1, signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, STAM1STAM-1 | |
| STAM | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title