missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STARD13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | STARD13 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18660668
|
Novus Biologicals
NBP2-49292-25ul |
25 μL |
 € 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605758
|
Novus Biologicals
NBP2-49292 |
0.1 mL |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STARD13 Polyclonal antibody specifically detects STARD13 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| STARD13 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ARHGAP37, DLC2, FLJ37385, GT650, Rho GTPase activating protein on chromosome 13q12, StAR-related lipid transfer (START) domain containing 13 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCC | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 90627 | |
| IgG | |
| Immunogen affinity purified |
Individuate un'opportunità di miglioramento?
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.