missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16131720

Abnova™ Streptavidin (Streptomyces avidinii) Recombinant Protein

Product Code. 16131720
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16131720 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16131720 Supplier Abnova™ Supplier No. P4990.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for SDS-PAGE

Sequence: MVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Specifications

Accession Number CAA27265, P22629
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation Liquid
Molecular Weight (g/mol) 17kDa
Name Streptavidin (Streptomyces avidinii) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing Loading 3 ug protein in 15% SDS-PAGE
Quantity 100 μg
Immunogen MVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Storage Requirements Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Common Name STREPTAVIDIN
Species E. coli
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.