missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STT3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 529.00
Specifications
| Antigen | STT3B |
|---|---|
| Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18417400
|
Novus Biologicals
NBP1-81884-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18218515
|
Novus Biologicals
NBP1-81884 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STT3B Polyclonal specifically detects STT3B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| STT3B | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 201595 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ90106, homolog of yeast STT3, Oligosaccharyl transferase subunit STT3B, SIMPEC 2.4.1.119, source of immunodominant MHC associated peptides, Source of immunodominant MHC-associated peptides homolog, STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae), STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B | |
| STT3B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title