missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUCLG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38318
This item is not returnable.
View return policy
Description
SUCLG1 Polyclonal specifically detects SUCLG1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SUCLG1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P53597 | |
| SUCLG1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIM | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 6.2.1, EC 6.2.1.4, FLJ21114, FLJ43513, GALPHA, MTDPS9, SCS-alpha, succinate-CoA ligase, alpha subunit, succinate-CoA ligase, GDP-forming, alpha subunit, succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial, Succinyl-CoA synthetase subunit alpha, SUCLA1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 8802 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction