missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUMO Activating Enzyme E1 (SAE1) Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | SUMO Activating Enzyme E1 (SAE1) |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18457641
|
Novus Biologicals
NBP2-13272-25ul |
25ul |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18044838
|
Novus Biologicals
NBP2-13272 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUMO Activating Enzyme E1 (SAE1) Polyclonal specifically detects SUMO Activating Enzyme E1 (SAE1) in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SUMO Activating Enzyme E1 (SAE1) | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| AOS1activator of SUMO1, FLJ3091, HSPC140, Sua1, SUA1sentrin/SUMO-activating protein AOS1, SUMO-1 activating enzyme E1 N subunit, SUMO1 activating enzyme subunit 1, SUMO-1 activating enzyme subunit 1, SUMO-activating enzyme subunit 1, Ubiquitin-like 1-activating enzyme E1A, ubiquitin-like protein SUMO-1 activating enzyme, UBLE1A | |
| SAE1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10055 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: NSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title