missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUMO4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | SUMO4 |
|---|---|
| Dilution | Western Blot 1:1000-1:2000, Immunohistochemistry 1:100-1:300, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18624362
|
Novus Biologicals
NBP2-95198-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605202
|
Novus Biologicals
NBP2-95198-0.1ml |
0.1 mL |
€ 470.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUMO4 Polyclonal antibody specifically detects SUMO4 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SUMO4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Phosphatase | |
| PBS (pH 7.3), 50% glycerol | |
| 387082 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000-1:2000, Immunohistochemistry 1:100-1:300, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| dJ281H8.4, IDDM5, small ubiquitin-like modifier 4 protein, Small ubiquitin-like protein 4, small ubiquitin-related modifier 4, SMT3 suppressor of mif two 3 homolog 2, SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 4 (yeast), SMT3H4, SUMO-4 | |
| A synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6). LSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title