missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SYAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56625
This item is not returnable.
View return policy
Description
SYAP1 Polyclonal specifically detects SYAP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| SYAP1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| DKFZp686K221, FLJ14495, FLJ44185, PRO3113, SAP47 homolog, synapse associated protein 1, synapse associated protein 1, SAP47 homolog, synapse-associated protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 94056 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SYAP1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATKKITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTND | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido