missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Synaptogyrin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
€ 267.00 - € 582.00
Specifications
| Antigen | Synaptogyrin 3 |
|---|---|
| Dilution | Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18445951
|
Novus Biologicals
NBP2-30475-25ul |
25ul |
€ 267.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18759913
|
Novus Biologicals
NBP2-30475 |
€ 582.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
Synaptogyrin 3 Polyclonal specifically detects Synaptogyrin 3 in Human samples. It is validated for Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| Synaptogyrin 3 | |
| Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O43761 | |
| 9143 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MGC20003, synaptogyrin 3, synaptogyrin-3 | |
| SYNGR3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title