missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Synaptophysin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 500.00
Specifications
| Antigen | Synaptophysin |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18424271
|
Novus Biologicals
NBP1-88112-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18493701
|
Novus Biologicals
NBP1-88112 |
0.1 mL |
€ 500.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Synaptophysin Polyclonal antibody specifically detects Synaptophysin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Synaptophysin | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Angiogenesis, Membrane Vesicle Markers, Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 6855 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Major synaptic vesicle protein p38, MRX, MRXSYP, synaptophysin | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title