missing translation for 'onlineSavingsMsg'
Learn More

SYVN1, Mouse anti-Human, Clone: 4H4, Abnova™

Mouse Monoclonal Antibody

Brand: Abnova H00084447-M01.50ug

Product Code. 16140767

€ 349.00 / 50µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRS

Specifications

Antigen	SYVN1
Classification	Monoclonal
Conjugate	Unconjugated
Gene	synovial apoptosis inhibitor 1, synoviolin
Gene Alias	HRD1/KIAA1810/MGC40372
Host Species	Mouse
Quantity	50 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Western Blot
Clone	4H4
Formulation	In 1x PBS, pH 7.4
Gene Accession No.	NM_032431
Gene Symbols	SYVN1
Immunogen	SYVN1 (NP_079434, 238 a.a. ∼ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Regulatory Status	RUO
Gene ID (Entrez)	84447
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2b κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

SYVN1, Mouse anti-Human, Clone: 4H4, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions