missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAK1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | TAK1L |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18212105
|
Novus Biologicals
NBP2-56145 |
100 μL |
€ 572.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625848
|
Novus Biologicals
NBP2-56145-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TAK1L Polyclonal specifically detects TAK1L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TAK1L | |
| Polyclonal | |
| Rabbit | |
| Human | |
| chromosome 21 open reading frame 7, HC21ORF7, putative gene, TGF-beta-activated kinase like10TAK1LTAK1-like protein, TAK1-like protein 1, TAK1-like protein 2, TAK1-like protein 4, TAKL, TAKL-1, TAKL-2, TAKL-4, TGF-beta activated kinase | |
| C21ORF7 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 56911 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title