missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TAO Kinase 1 Antibody, Novus Biologicals™

TAO Kinase 1 Antibody, Novus Biologicals™

Product Code. p-200104059 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30231233 100 μL 100µL
30231114 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30231233 Supplier Novus Biologicals Supplier No. NBP333291100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

TAO Kinase 1 Monoclonal antibody specifically detects TAO Kinase 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TAO Kinase 1
Applications ELISA, Western Blot
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias EC 2.7.11, FLJ14314, hKFC-B, KIAA1361STE20-like kinase PSK2, Kinase from chicken homolog B, MAP3K16EC 2.7.11.1, MARKKmicrotubule affinity regulating kinase kinase, PSK2serine/threonine kinase TAO1, serine/threonine-protein kinase TAO1, TAO kinase 1, TAO1serine/threonine protein kinase TAO1 homolog, Thousand and one amino acid protein 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAO Kinase 1 (NP_065842.1).,, Sequence:, FSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRS
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline GPCR, Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 57551
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.