missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TATDN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | TATDN2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18202551
|
Novus Biologicals
NBP2-58326 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18623588
|
Novus Biologicals
NBP2-58326-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TATDN2 Polyclonal specifically detects TATDN2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| TATDN2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 9797 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKVKHNWSSTSEGCPRKRSCLREPCDVAPSSRPAQRSASRSGGPSSPKRLKAQKEDDVACSRRLSWGSSRRRNNSSSS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| KIAA0218, MGC126819, MGC126825, putative deoxyribonuclease TATDN2, TatD DNase domain containing 2 | |
| TATDN2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel