missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBLR1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | TBLR1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18649041
|
Novus Biologicals
NBP2-94126-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624352
|
Novus Biologicals
NBP2-94126-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TBLR1 Polyclonal antibody specifically detects TBLR1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| TBLR1 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Wnt Signaling Pathway | |
| PBS (pH 7.3), 50% glycerol | |
| 79718 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| C21, DC42, F-box-like/WD repeat-containing protein TBL1XR1, FLJ12894, IRA1Transducin beta-like 1X-related protein 1, nuclear receptor co-repressor/HDAC3 complex subunit, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBLR1TBL1-related protein 1, transducin (beta)-like 1 X-linked receptor 1, transducin (beta)-like 1X-linked receptor 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-170 of human TBLR1 (NP_078941.2). QQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHES | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title