missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCEB3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92482
This item is not returnable.
View return policy
Description
TCEB3B Polyclonal specifically detects TCEB3B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| TCEB3B | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| 110kDa Elongin A, EloA2, Elongin-A2, HsT832, MGC119351, RNA polymerase II transcription factor SIII subunit A2, TCEB3Ltranscription elongation factor (SIII) elongin A2 elongin A2, Transcription elongation factor B polypeptide 3B, transcription elongation factor B polypeptide 3B (elongin A2) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51224 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TCEB3B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GHKSSRQEKRPLCAQGDWHSPTLIREKSCGACLREETPRMPSWASARDRQPSDFKTDKEGGQAGSGQRVPALEEAPDSHQ | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction