missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCF-2/HNF-1 beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
€ 353.00 - € 573.00
Specifications
| Antigen | TCF-2/HNF-1 beta |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Chromatin Immunoprecipitation (ChIP) |
| Applications | ChIP Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18455051
|
Novus Biologicals
NBP1-89680-25ul |
25 μL |
€ 353.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18711034
|
Novus Biologicals
NBP1-89680 |
0.1 mL |
€ 573.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TCF-2/HNF-1 beta Polyclonal specifically detects TCF-2/HNF-1 beta in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP).Specifications
| TCF-2/HNF-1 beta | |
| ChIP Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| P35680 | |
| 6928 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Simple Western 1:30, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Chromatin Immunoprecipitation (ChIP) | |
| Polyclonal | |
| Rabbit | |
| Diabetes Research | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FJHN, hepatocyte nuclear factor 1-beta, HNF1 beta A, HNF1 homeobox B, HNF-1B, HNF1beta, HNF-1-beta, HNF2, Homeoprotein LFB3, LFB3, LF-B3, MODY5HPC11, TCF-2, TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor, Transcription factor 2, transcription factor 2, hepatic, Variant hepatic nuclear factor 1, vHNF1 | |
| HNF1B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title