missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCF7/TCF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 559.00
Specifications
| Antigen | TCF7/TCF1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18242755
|
Novus Biologicals
NBP2-57570 |
100 μL |
€ 559.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18683537
|
Novus Biologicals
NBP2-57570-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TCF7/TCF1 Polyclonal specifically detects TCF7/TCF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| TCF7/TCF1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction, Wnt Signaling Pathway | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6932 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| FLJ36364, MGC47735, T-cell factor 1, T-cell specific, TCF1, TCF-7, transcription factor 7 (T-cell specific, HMG-box) | |
| TCF7 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title