missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEAD4 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 213.00 - € 507.00
Specifications
| Antigen | TEAD4 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231119
|
Novus Biologicals
NBP3-33455-20ul |
20 μL |
€ 213.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229369
|
Novus Biologicals
NBP3-33455-100ul |
100 μL |
€ 507.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TEAD4 Monoclonal antibody specifically detects TEAD4 in Human samples. It is validated for ELISA,Western BlotSpecifications
| TEAD4 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 7004 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| EFTR-2, hRTEF-1B, related transcription enhancer factor 1B, RTEF1RTEF-1, TCF13L1MGC9014, TEA domain family member 4TEF3, TEAD-4, TEF-3, TEFR-1, Transcription factor 13-like 1, Transcription factor RTEF-1, transcriptional enhancer factor 1-related, transcriptional enhancer factor 3, transcriptional enhancer factor TEF-3 | |
| A synthetic peptide corresponding to a sequence within amino acids 140-240 of human TEAD4 (Q15561).,, Sequence:, SATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title