missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEF1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-95204-0.02ml
This item is not returnable.
View return policy
Description
TEF1 Polyclonal antibody specifically detects TEF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), ChIP assay (ChIP)
Specifications
| TEF1 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Chromatin Immunoprecipitation (ChIP) 1:50-1:200 | |
| NTEF-1, protein GT-IIC, TEA domain family member 1 (SV40 transcriptional enhancer factor), TEAD-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK | |
| 0.02 mL | |
| Cardiovascular Biology, Cell Biology | |
| 7003 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), ChIP Assay | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction