missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEK, Mouse anti-Human, Clone: 4G9, Abnova™
Mouse Monoclonal Antibody
Brand: Abnova H00007010-M15.100ug
This item is not returnable.
View return policy
Description
Sequence: NQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQD&asterisk;Specifications
| TEK | |
| Monoclonal | |
| Unconjugated | |
| TEK tyrosine kinase, endothelial | |
| CD202B/TIE-2/TIE2/VMCM/VMCM1 | |
| Mouse | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody |
| ELISA, Western Blot | |
| 4G9 | |
| In 1x PBS, pH 7.4 | |
| NM_000459 | |
| TEK | |
| TEK (NP_000450, 66 a.a. ∼ 185 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| RUO | |
| 7010 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction