missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEM Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94390-0.02ml
This item is not returnable.
View return policy
Description
TEM Polyclonal antibody specifically detects TEM in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| TEM | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| BRICD4, BRICHOS domain containing 4, CHM1L, chondromodulin-I-like protein, hChM1L, hTeM, myodulin, TEM, tendin, tenomodulin, UNQ771/PRO1565 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 92-187 of human TNMD (NP_071427.2). SGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWIN | |
| 0.02 mL | |
| Angiogenesis, Cardiovascular Biology | |
| 64102 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction