missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TEP1 Antibody - BSA Free, Novus Biologicals™

TEP1 Antibody - BSA Free, Novus Biologicals™

Product Code. 18627300 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18627300 0.02 mL 0.02mL
18603491 0.1 mL 0.01mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18627300 Supplier Novus Biologicals Supplier No. NBP2934350.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TEP1 Polyclonal antibody specifically detects TEP1 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TEP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias p240telomerase protein component 1, telomerase-associated protein 1VAULT2, TLP1p80 telomerase homolog, TP1Telomerase protein 1, TROVE domain family, member 1, TROVE1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2523-2627 of human TEP1 (NP_009041.2). TCRESDASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 7011
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.