missing translation for 'onlineSavingsMsg'
Learn More
Learn More
tescalcin Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 196.00 - € 468.00
Specifikationer
| Antigen | tescalcin |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Beskrivning
tescalcin Polyclonal antibody specifically detects tescalcin in Human samples. It is validated for Western BlotSpecifikationer
| tescalcin | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Endocrinology, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 54997 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| calcineurin B homologous protein 3, CHP3, TSC | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3). YRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel