missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TGFBR3L Polyclonal specifically detects TGFBR3L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | TGFBR3L |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | TGF-Beta Receptor Type III-Like Protein, TGF-Beta Receptor Type-3-Like Protein, TGFR-3L, Transforming Growth Factor Beta Receptor 3 Like, Transforming Growth Factor, Beta Receptor III-Like, Transforming Growth Factor-Beta Receptor Type 3-Like Protein, Transforming Growth Factor-Beta Receptor Type III-Like Protein |
| Gene Symbols | TGFBR3L |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDTEDVFP |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?