missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thromboxane synthase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 369.00 - € 539.00
Specifications
| Antigen | Thromboxane synthase |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18441632
|
Novus Biologicals
NBP2-33946-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18133742
|
Novus Biologicals
NBP2-33946 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Thromboxane synthase Polyclonal specifically detects Thromboxane synthase in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Thromboxane synthase | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P24557 | |
| 6916 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CYP5A1family 5, subfamily A, polypeptide 1, CYP5FLJ52771, EC 5.3.99.5, GHOSAL, platelet, cytochrome P450, subfamily V, thromboxane A synthase 1 (platelet), thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V), thromboxane-A synthase, TXA synthase | |
| TBXAS1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title