missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TIAL1 Polyclonal antibody specifically detects TIAL1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | TIAL1 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 350 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 266-375 of human TIAL1 (NP_003243.1).,, Sequence:, EGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?