missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIE1, Mouse anti-Human, Clone: 2C7, Abnova™
Mouse Monoclonal Antibody
Brand: Abnova H00007075-M19.100ug
This item is not returnable.
View return policy
Description
Sequence: TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG&asterisk;Specifications
| TIE1 | |
| Monoclonal | |
| Unconjugated | |
| tyrosine kinase with immunoglobulin-like and EGF-like domains 1 | |
| JTK14/TIE | |
| Mouse | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody |
| ELISA, Western Blot | |
| 2C7 | |
| In 1x PBS, pH 7.4 | |
| NM_005424 | |
| TIE1 | |
| TIE1 (NP_005415, 536 a.a. ∼ 643 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| RUO | |
| 7075 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction