missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIMM17B Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 213.00 - € 507.00
Specifications
| Antigen | TIMM17B |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230138
|
Novus Biologicals
NBP3-33481-20ul |
20 μL |
€ 213.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232323
|
Novus Biologicals
NBP3-33481-100ul |
100 μL |
€ 507.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TIMM17B Monoclonal antibody specifically detects TIMM17B in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| TIMM17B | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Endocrinology | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 10245 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| inner mitochondrial membrane preprotein translocase, JM3, mitochondrial import inner membrane translocase subunit Tim17-B, TIM17BDXS9822, translocase of inner mitochondrial membrane 17 homolog B (yeast) | |
| A synthetic peptide corresponding to a sequence within amino acids 60-160 of human TIMM17B (NP_005825.1).,, Sequence:, PQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title