missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIP120A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | TIP120A |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18266725
|
Novus Biologicals
NBP2-56630 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18646728
|
Novus Biologicals
NBP2-56630-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TIP120A Polyclonal specifically detects TIP120A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| TIP120A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| cullin-associated and neddylation-dissociated 1, Cullin-associated and neddylation-dissociated protein 1, cullin-associated NEDD8-dissociated protein 1, DKFZp434M1414, FLJ90441, KIAA0829FLJ10114, p120 CAND1, TBP interacting protein, TBP-interacting protein 120A, TBP-interacting protein of 120 kDa A, TIP120AFLJ38691, TIP120FLJ10929 | |
| CAND1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 55832 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel