missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIPRL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55024
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
TIPRL Polyclonal specifically detects TIPRL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifica
| TIPRL | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| dJ69E11.3, MGC3794, putative MAPK activating protein, Putative MAPK-activating protein PM10, TIP41, TOR signaling pathway regulator-like (S. cerevisiae), TIP41-like protein, TIP41Type 2A-interacting protein, TIPTIP41, TOR signalling pathway regulator-like (S. cerevisiae) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 261726 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TIPRL | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLI | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto