missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TL1A/TNFSF15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00
Specifications
| Antigen | TL1A/TNFSF15 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TL1A/TNFSF15 Polyclonal specifically detects TL1A/TNFSF15 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TL1A/TNFSF15 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cell Cycle and Replication | |
| MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A, VEGI192A, VEGITNF ligand-related molecule 1 | |
| TNFSF15 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 9966 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title