missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TLR6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifica
| Antigen | TLR6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|
18268364
|
Novus Biologicals
NBP2-57646 |
100 μL |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18681708
|
Novus Biologicals
NBP2-57646-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
TLR6 Polyclonal specifically detects TLR6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| TLR6 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Cytokine Research, Immunology, Innate Immunity, Prostate Cancer, Toll Like Receptors | |
| CD286, CD286 antigen, toll-like receptor 6 | |
| TLR6 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 10333 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts