missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM135 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49601
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
TMEM135 Polyclonal antibody specifically detects TMEM135 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| TMEM135 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| DKFZp686I1974, FLJ22104, transmembrane protein 135 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC | |
| 0.1 mL | |
| metabolism | |
| 65084 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu