missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TMEM184A Polyclonal antibody specifically detects TMEM184A in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | TMEM184A |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 647 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | FLJ24011, transmembrane protein 184A |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-413 of human TMEM184A (NP_001091089.1).,, Sequence:, FPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?