missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM210 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | TMEM210 |
|---|---|
| Dilution | Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18691209
|
Novus Biologicals
NBP2-49498-25ul |
25 μL |
 € 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18685847
|
Novus Biologicals
NBP2-49498 |
0.1 mL |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM210 Polyclonal antibody specifically detects TMEM210 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| TMEM210 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Transmembrane Protein 210 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AKGETCPRQVDNRLVENFGVQEDLMDLHPVYVESQLMDADLEVSLVPPLEDQSLVAIPMEASSEEP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 100505993 | |
| IgG | |
| Immunogen affinity purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel