missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM63B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 518.70
Specifications
| Antigen | TMEM63B |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18275843
|
Novus Biologicals
NBP2-58473 |
100 μL |
€ 549.00 € 518.70 / 100µL Save € 30.30 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667968
|
Novus Biologicals
NBP2-58473-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM63B Polyclonal specifically detects TMEM63B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TMEM63B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55362 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KYLSAHNYKIEHTETDTVDPRSNGRPPTAAAVPKSAKYIAQVLQDSEVDGDGDGAPGSSGDEPPSSSSQDEELLMPPD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| transmembrane protein 63B | |
| TMEM63B | |
| IgG | |
| Affinity Purified |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel