missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM72 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 267.00 - € 565.00
Specifications
| Antigen | TMEM72 |
|---|---|
| Dilution | Western Blot -Validated from a verified customer review, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18673928
|
Novus Biologicals
NBP2-49377-25ul |
25 μL |
€ 267.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18617686
|
Novus Biologicals
NBP2-49377 |
0.1 mL |
€ 565.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM72 Polyclonal antibody specifically detects TMEM72 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| TMEM72 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| bA285G1.3, C10orf127, DKFZp686M0585, kidney-specific secretory protein of 37 kDa, KSP37, MGC157906, transmembrane protein 72 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot -Validated from a verified customer review, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 643236 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title