missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
€ 280.00 - € 624.00
Specifications
| Antigen | TMX2 |
|---|---|
| Dilution | Western Blot 1:100-1:500, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18431241
|
Novus Biologicals
NBP1-87305-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18798723
|
Novus Biologicals
NBP1-87305 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMX2 Polyclonal specifically detects TMX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TMX2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51075 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 1:100-1:500, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cell proliferation-inducing gene 26 protein, DKFZp781O2021, growth-inhibiting gene 11, MGC111151, PDIA12, PIG26, protein disulfide isomerase family A, member 12, thioredoxin domain containing 14, Thioredoxin domain-containing protein 14, thioredoxin-related transmembrane protein 2, TXNDC14 | |
| TMX2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title