missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TNFAIP1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94181-0.02ml
This item is not returnable.
View return policy
Description
TNFAIP1 Polyclonal antibody specifically detects TNFAIP1 in Human samples. It is validated for Western Blot
Specifications
| TNFAIP1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000 | |
| B12, B61, BACURD2, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2, BTB/POZ domain-containing protein TNFAIP1, EDP1, hBACURD2, MGC2317, Protein B12, tumor necrosis factor, alpha-induced protein 1 (endothelial), Tumor necrosis factor, alpha-induced protein 1, endothelial | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human TNFAIP1 (NP_066960.1). DTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKL | |
| 0.02 mL | |
| Adaptive Immunity, Asthma, Autophagy, Cancer, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity | |
| 7126 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur