missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TOMM34 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 540.75
Specifications
| Antigen | TOMM34 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18477800
|
Novus Biologicals
NBP1-81655-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18449710
|
Novus Biologicals
NBP1-81655 |
0.1 mL |
€ 572.00 € 540.75 / 0.10mL Save € 31.25 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TOMM34 Polyclonal antibody specifically detects TOMM34 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| TOMM34 | |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 10953 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| hTom34, HTOM34P, mitochondrial import receptor subunit TOM34, outer mitochondrial membrane translocase (34kD), TOM34, Translocase of outer membrane 34 kDa subunit, translocase of outer mitochondrial membrane 34, URCC3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title