missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Topoisomerase I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 267.00 - € 573.00
Specifications
| Antigen | Topoisomerase I |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Proximity Ligation Assay Reported in scientific literature (PMID:35013124). |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Proximity Ligation Assay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18432692
|
Novus Biologicals
NBP1-90365-25ul |
25 μL |
€ 267.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18051594
|
Novus Biologicals
NBP1-90365 |
0.1 mL |
€ 573.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Topoisomerase I Polyclonal specifically detects Topoisomerase I in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Topoisomerase I | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Proximity Ligation Assay | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| DNA topoisomerase 1, DNA topoisomerase I, EC 5.99.1.2, TOPI, topoisomerase (DNA) I, type I DNA topoisomerase | |
| TOP1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Proximity Ligation Assay Reported in scientific literature (PMID:35013124). | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7150 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title