missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TORC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 572.00
Specifications
| Antigen | TORC1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18464332
|
Novus Biologicals
NBP1-89865-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18248387
|
Novus Biologicals
NBP1-89865 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TORC1 Polyclonal antibody specifically detects TORC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifications
| TORC1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| CREB regulated transcription coactivator 1, FLJ14027WAMTP1, KIAA0616Transducer of regulated cAMP response element-binding protein 1, MECT1CREB-regulated transcription coactivator 1, mucoepidermoid carcinoma translocated 1, Mucoepidermoid carcinoma translocated protein 1, TORC1TORC-1, Transducer of CREB protein 1, transducer of regulated cAMP response element-binding protein (CREB) 1 | |
| CRTC1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human TORC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 23373 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title