missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TP53I11 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93452-0.1ml
This item is not returnable.
View return policy
Description
TP53I11 Polyclonal antibody specifically detects TP53I11 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| TP53I11 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin | |
| p53-induced protein, PIG11p53-induced gene 11 protein, tumor protein p53 inducible protein 11, tumor protein p53-inducible protein 11 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TP53I11 (NP_001245249.1). MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Biology | |
| 9537 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction