missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TPD52 Antibody (1B6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00007163-M01
This item is not returnable.
View return policy
Description
TPD52 Monoclonal antibody specifically detects TPD52 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
| TPD52 | |
| Monoclonal | |
| Unconjugated | |
| NP_005070 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 1B6 | |
| In 1x PBS, pH 7.4 | |
| D52, hD52, N8L, PC-1, PrLZ, prostate and colon associated protein, prostate leucine zipper, Protein N8, tumor protein D52 | |
| TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL | |
| 0.1 mg | |
| Cancer | |
| 7163 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2b κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction