missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAF-5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93920-0.1ml
This item is not returnable.
View return policy
Description
TRAF-5 Polyclonal antibody specifically detects TRAF-5 in Human samples. It is validated for Western Blot
Specifications
| TRAF-5 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MGC:39780, RNF84RING finger protein 84, TNF receptor-associated factor 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TRAF5 (NP_665702.1). MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPI | |
| 0.1 mL | |
| Apoptosis, Signal Transduction, Zinc Finger | |
| 7188 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction