missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Transportin 1 Antibody - BSA Free, Novus Biologicals™

Transportin 1 Antibody - BSA Free, Novus Biologicals™

Product Code. 18652421 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18652421 0.02 mL 0.02mL
18653490 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18652421 Supplier Novus Biologicals Supplier No. NBP2932330.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Transportin 1 Polyclonal antibody specifically detects Transportin 1 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Transportin 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:200-1:1000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias importin beta 2, Importin beta-2, IPO2, karyopherin (importin) beta 2, MIP1Karyopherin beta-2, MIPM9 region interaction protein, transportin 1, transportin-1, TRNKPNB2importin 2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 790-890 of human Transportin 1 (NP_002261.3). CPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKE
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Cycle and Replication, Cellular Markers, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, DNA replication Transcription Translation and Splicing, HIF Target Genes, Hypoxia, Neuroscience, Neurotransmission, p53 Pathway, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 3842
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.