missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TREX1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68672-25ul
This item is not returnable.
View return policy
Description
TREX1 Polyclonal antibody specifically detects TREX1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| TREX1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| 3'-5' exonuclease TREX1, AGS1, Aicardi-Goutieres syndrome 1, CRV, DKFZp434J0310, DNase III, DRN3, EC 3.1.11.2, HERNS, three prime repair exonuclease 1,3' repair exonuclease 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSRE | |
| 25 μL | |
| DNA Repair, Editing and Processing Endonucleases | |
| 11277 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction