missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18607565

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - IHC-Prediluted, R&D Systems™

Product Code. 18607565 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
7 mL
Unit Size:
7mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18607565 7 mL 7mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18607565 Supplier Novus Biologicals Supplier No. NBP244381
 Restricted Item
Estimated Shipment: 26-11-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen DOG1/TMEM16A
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone DG1/447 + DOG-1.1
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 0.25 - 0.5 μg/mL
Formulation 10 mM PBS with 0.05% BSA
Gene Alias ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Host Species Mouse
Immunogen Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Purification Method Protein A or G purified
Quantity 7 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55107
Target Species Human
Content And Storage Store at 4°C.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.